maldi-sample-preparation-the-ultra-thin-layer-method

MALDI Sample Preparation: the Ultra Thin Layer Method

This video demonstrates the preparation of an ultra-thin matrix/analyte layer for analyzing peptides and proteins by Matrix-Assisted Laser Desorption ...

Mnb/Dyrk1A is a proline-directed serine/threonine kinase implicated in Down's syndrome. Mnb/Dyrk1A was shown to phosphorylate dynamin 1 and alter its interactions with several SH3 domain-containing endocytic accessory proteins. To determine the mechanism of regulation, we mapped the Mnb/Dyrk1A phosphorylation sites in dynamin 1. Using a combination of deletion mutants and synthetic peptides, three potential Mnb/Dyrk1A phosphorylation sites (S778, S795, and S857) were first identified. Phosphorylation at S795 and S857 was confirmed in full-length dynamin 1, and S857 was subsequently determined to be the major Mnb/Dyrk1A phosphorylation site in vitro. Phosphorylation at S857 was demonstrated to be the basis for altering the binding of dynamin 1 to amphiphysin 1 and Grb 2 by site-directed mutants mimicking phosphorylation. Furthermore, S857 of dynamin 1 is phosphorylated by the endogenous kinase in brain extracts and in PC12 cells. In PC12 cells, the state of S857 phosphorylation is dependent on membrane potentials. These results suggest that S857 phosphorylation is a physiological event, which regulates the binding of dynamin 1 to SH3 domain-containing proteins. Since S857 is unique to dynamin 1xa isoforms, Mnb/Dyrk1A regulation of dynamin 1 is expected to be specific to these spliced variants.

Mnb/Dyrk1A phosphorylation regulates the interaction of dynamin 1 with SH3 domain-containing proteins.

Mnb/Dyrk1A Phosphorylierung reguliert die Interaktion von Dynamin 1 mit SH3-Dom&#xE4;ne enthaltenden Proteine.

The presence of alanine (Ala) or acetyl serine (AcSer) instead of the normal Val residues at the N-terminals of either the alpha- or the beta-subunits of human adult hemoglobin confers some novel and unexpected features on the protein. Mass spectrometric analysis confirmed that these substitutions were correct and that they were the only ones. Circular dichroism studies indicated no global protein conformational changes, and isoelectric focusing showed the absence of impurities. The presence of Ala at the N-terminals of the alpha-subunits of liganded hemoglobin results in a significantly increased basicity (increased pK(a) values) and a reduction in the strength of subunit interactions at the allosteric tetramer-dimer interface. Cooperativity in O(2) binding is also decreased. Substitution of Ala at the N-terminals of the beta-subunits gives neither of these effects. The substitution of Ser at the N terminus of either subunit leads to its complete acetylation (during expression) and a large decrease in the strength of the tetramer-dimer allosteric interface. When either Ala or AcSer is present at the N terminus of the alpha-subunit, the slope of the plot of the tetramer-dimer association/dissociation constant as a function of pH is decreased by 60%. It is suggested that since the network of interactions involving the N and C termini of the alpha-subunits is less extensive than that of the beta-subunits in liganded human hemoglobin disruptions there are likely to have a profound effect on hemoglobin function such as the increased basicity, the effects on tetramer strength, and on cooperativity.

N-terminal acetylation and protonation of individual hemoglobin subunits: position-dependent effects on tetramer strength and cooperativity.

N-terminale Acetylierung und Protonierung der einzelnen H&#xE4;moglobin-Untereinheiten: ortsabh&#xE4;ngigen Auswirkungen auf die St&#xE4;rke und Tetramer Kooperativit&#xE4;t.

Determination of site-specific changes in the levels of protein phosphorylation in mammals presents a formidable analytical challenge. Here, we demonstrate a strategy for such analyses utilizing a combination of stable isotope chemical labeling and tandem mass spectrometry. Phosphoproteins of interest are isolated from two sets of animals that have undergone differential drug treatments, separated by SDS-PAGE, excised, and subjected to in-gel enzymatic digestion. Using a simple chemical labeling step, we introduce stable, isotopically distinct mass tags into each of the two sets of peptides that originate from the samples under comparison, mix the samples, and subject the resulting mixture to a procedure based on our previously reported hypothesis-driven multistage MS (HMS-MS) method (Chang, E. J.; Archambault, V.; McLachlin, D. T.; Krutchinsky, A. N.; Chait, B. T. Anal. Chem. 2004, 76, 4472-4483). The method takes advantage of the dominant loss of H3PO4 during MS/MS from singly charged phosphopeptide ions produced by matrix-assisted laser desorption/ionization (MALDI) in the ion trap mass spectrometer. In the present work, quantitation is achieved by isolating the range of m/z values that include both isotopic forms of the putative phosphopeptide and measuring the relative intensities of the two resulting -98-Da fragment ion peaks. This MS/MS measurement can be repeated on the same MALDI sample for all potential phosphopeptide ion pairs that we hypothesize might be produced from the protein under study. Use of MS/MS for quantitation greatly increases the sensitivity of the method and allows us to measure relatively low levels of phosphorylation, phosphopeptides, or both that are not easily observable by single-stage MS. We apply the current method to the determination of changes in the levels of phosphorylation in DARPP-32 from the mouse striatum upon treatment of animals with psychostimulant drugs.

Quantitative analysis of protein phosphorylation in mouse brain by hypothesis-driven multistage mass spectrometry.

Bestimmung der standortspezifische &Auml;nderungen bei der H&ouml;he der Proteinphosphorylierung bei S&auml;ugetieren stellt eine gewaltige analytische Herausforderung. Hier zeigen wir eine Strategie f&uuml;r solche Analysen unter Verwendung einer Kombination aus stabilen Isotop chemischen Kennzeichnung und Tandem-Massenspektrometrie. Phosphoproteine von Interesse sind isoliert von zwei Gruppen von Tieren, die differenzielle medikament&ouml;se Behandlungen unterzogen, getrennt durch SDS-PAGE, herausgeschnitten und enzymatische in-Gel-Verdau unterworfen haben. Mit eine einfache chemischen Kennzeichnung Schritt, stellen wir stabile, isotopischer unterschiedliche Masse Tags in jedem der beiden S&auml;tze von Peptiden, die stammen aus den Beispielen unter Vergleich, mischen Sie die Proben und die resultierende Mischung an eine Prozedur auf unserer bereits berichtet Hypothese angetriebenen mehrstufigen MS (HMS-MS) Methode (Chang, E. J.; auf Grundlage Archambault, V.; McLachlin, D. T.; Krutchinsky, A. N.; Chait, B. T. Anal. Chem. 2004, 76, 4472-4483). Die Methode nutzt die dominante Verlust von H3PO4 w&auml;hrend MS/MS aus einzeln aufgeladene Phosphopeptide Ionen von Matrix assisted Laser Desorption/Ionisation (MALDI) in den Ionenfallen-Massenspektrometer produziert. In der vorliegenden Arbeit quantitative Bestimmung erfolgt durch Isolierung des Bereichs m/Z-Werte, die beiden Isotopen die vermeintliche Phosphopeptide z&auml;hlen und messen die relativen Intensit&auml;ten der beiden resultierenden-98-Da Fragment Ion Gipfeln. Diese MS/MS-Messung kann an der gleichen MALDI-Probe f&uuml;r alle potenziellen Phosphopeptide-Ion-Paare, die wir theoretisieren produziert werden k&ouml;nnte, vom Protein unter Studie wiederholt werden. Verwendung von MS/MS f&uuml;r quantitative Bestimmung erheblich die Empfindlichkeit der Methode erh&ouml;ht und uns erm&ouml;glicht, relativ niedrigen Niveau der Phosphorylierung, Messen Phosphopeptides, oder beide, sind nicht leicht beobachtbaren durch einstufige MS. Wir gilt die aktuelle Methode zur Bestimmung von &Auml;nderungen bei der H&ouml;he der Phosphorylierung DARPP-32 aus der Maus Striatum bei der Behandlung von Tieren mit Psychostimulanzien Drogen.

Quantitative Analyse von Proteinphosphorylierung in Maus Brain von Hypothese angetriebenen mehrstufigen Massenspektrometrie.

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

Neun Chromatographische Komponenten mit Trypsin Inhibitor-Aktivit&auml;t wurden in eine gesamte Rendite von 46 % der Aktivit&auml;t und 0,05 % Eiwei&szlig; aus Sechium Edule Samen von Aceton Fraktionierung, Gel Filtration, Affinit&auml;ts-Chromatographie und RP-HPLC isoliert. Die Komponenten, die mit h&ouml;chsten Ertrag der Gesamtaktivit&auml;t und h&ouml;chste spezifische Aktivit&auml;t wurden sequenziert Edman-Abbau und ihre molekularen Massen durch Massenspektrometrie bestimmt. Die Inhibitoren enthalten 31, 32 und 27 R&uuml;ckst&auml;nde pro Molek&uuml;l und ihre Sequenzen waren: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG und SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa und SETI-IIb, differierten von amino-Terminal E in IIb Form, waren nicht trennbar, unter den Bedingungen besch&auml;ftigt. Die Sequenzen sind konsistent mit Konsens Sequenzen aus 37 andere Hemmer gewonnen: CPriI1meCk_DSDCla_C_C_G_CG, wo Gro&szlig;buchstaben sind invariant Aminos&auml;urereste um und Kleinbuchstaben sind in dieser Position die meisten erhalten. SETI-II und SETI-V bilden komplexe mit Trypsin mit einem 1:1-St&ouml;chiometrie und Dissoziation Konstanten 5.4x10(-11) M und 1.1x10(-9) M, beziehungsweise.

Niedermolekularen Squash Trypsin-Inhibitoren von Sechium Edule Samen.

The different types of naturally occurring, normal human hemoglobins vary in their tetramer-dimer subunit interface strengths (stabilities) by three orders of magnitude in the liganded (CO or oxy) state. The presence of embryonic zeta-subunits leads to an average 20-fold weakening of tetramer-dimer interfaces compared to corresponding hemoglobins containing adult alpha-subunits. The dimer-monomer interfaces of these hemoglobins differ by at least 500-fold in their strengths; such interfaces are weak if they contain zeta-subunits and exchange with added beta-subunits in the form of beta(4) (HbH) significantly faster than do those with alpha-subunits. Subunit exchange occurs at the level of the dimer, although tetramer formation reciprocally influences the amount of dimer available for exchange. Competition between subunit types occurs so that pairs of weak embryonic hemoglobins can exchange subunits to form the stronger fetal and adult hemoglobins. The dimer strengths increase in the order Hb Portland-2 (zeta(2)beta(2)) < Hb Portland-1 (zeta(2)gamma(2)) approximately equal Hb Gower-1 (zeta(2)epsilon(2)) < Hb Gower-2 (alpha(2)epsilon(2)) < HbF(1) < HbF (alpha(2)gamma(2)) < HbA(2) (alpha(2)delta(2)), i.e., from embryonic to fetal to adult types, representing maturation from weaker to stronger monomer-monomer subunit contacts. This increasing order recapitulates the developmental order in which globins are expressed (embryonic --> fetal --> adult), suggesting that the intrinsic binding properties of the subunits themselves regarding the strengths of interfaces they form with competing subunits play an important role in the dynamics of protein assemblies and networks.

Human embryonic, fetal, and adult hemoglobins have different subunit interface strengths. Correlation with lifespan in the red cell.

Die verschiedenen Arten von nat&uuml;rlich vorkommenden, normale menschliche H&auml;moglobin unterscheiden sich in ihren Tetramer-Dimer Untereinheit Schnittstelle st&auml;rken (Stabilit&auml;ten) um drei Gr&ouml;&szlig;enordnungen in die liganded (CO oder Autogen) Zustand. Das Vorhandensein von embryonalen Zeta-Untereinheiten f&uuml;hrt zu einer durchschnittlichen Zwanzigfache Schw&auml;chung des Tetramer-Dimer Schnittstellen im Vergleich zu entsprechenden H&auml;moglobin, Erwachsene Alpha-Untereinheiten enth&auml;lt. Die Dimer-Monomer-Schnittstellen von diesen H&auml;moglobin unterscheiden sich von mindestens 500-fold in ihren St&auml;rken; solche Schnittstellen sind schwach, wenn sie Zeta-Untereinheiten enthalten und Austausch mit zus&auml;tzlichen Beta-Untereinheiten in Form von beta(4) (HbH) deutlich schneller als diejenigen mit Alpha-Untereinheiten zu tun. Untereinheit Austausch tritt auf der Ebene der Dimer, obwohl Tetramer Bildung gegenseitig die H&ouml;he der Dimer verf&uuml;gbar f&uuml;r Exchange beeinflusst. Wettbewerb zwischen Untereinheit Arten tritt damit Paare von schwachen embryonalen H&auml;moglobin Untereinheiten bilden die st&auml;rkeren fetalen und adulten H&auml;moglobin austauschen k&ouml;nnen. Die Dimer st&auml;rken zu erh&ouml;hen, in der Reihenfolge Hb-Portland-2 (zeta(2)beta(2)) &lt; Hb-Portland-1 (zeta(2)gamma(2)) etwa gleich Hb Gower-1 (zeta(2)epsilon(2)) &lt; Hb Gower-2 (alpha(2)epsilon(2)) &lt; HbF(1) &lt; HbF (alpha(2)gamma(2)) &lt; HbA(2) (alpha(2)delta(2)), d. h. aus embryonalen zu fetalen zu erwachsenen typen, die reifung von schw&auml;cheren zu st&auml;rkeren Monomer-Monomer untereinheit kontakte. Diese zunehmende ordnung rekapituliert die entwicklungsbiologie reihenfolge in der Globins ausgedr&uuml;ckt werden (embryonalen--&gt; fetale--&gt; Erwachsener), darauf hindeutet, dass die systeminterne Bindungseigenschaften der Untereinheiten sich &uuml;ber die St&auml;rken der Schnittstellen, die sie bilden mit konkurrierenden Untereinheiten in der Dynamik von Protein-Baugruppen und Netzwerken eine wichtige Rolle spielen.

Menschliche embryonale, fetale und adulten H&auml;moglobin haben unterschiedliche Untereinheit Schnittstelle st&auml;rken. Korrelation mit Lebensdauer in den roten Blutk&ouml;rperchen.

The vector-borne, protistan parasite Trypanosoma brucei is the only known eukaryote with a multifunctional RNA polymerase I that, in addition to ribosomal genes, transcribes genes encoding the parasite's major cell-surface proteins-the variant surface glycoprotein (VSG) and procyclin. In the mammalian bloodstream, antigenic variation of the VSG coat is the parasite's means to evade the immune response, while procyclin is necessary for effective establishment of trypanosome infection in the fly. Moreover, the exceptionally high efficiency of mono-allelic VSG expression is essential to bloodstream trypanosomes since its silencing caused rapid cell-cycle arrest in vitro and clearance of parasites from infected mice. Here we describe a novel protein complex that recognizes class I promoters and is indispensable for class I transcription; it consists of a dynein light chain and six polypeptides that are conserved only among trypanosomatid parasites. In accordance with an essential transcriptional function of the complex, silencing the expression of a key subunit was lethal to bloodstream trypanosomes and specifically affected the abundance of rRNA and VSG mRNA. The complex was dubbed class I transcription factor A.

Multifunctional class I transcription in Trypanosoma brucei depends on a novel protein complex.

Die Vektor-borne, Protistan Parasit Trypanosoma Brucei ist die einzige bekannte Eukaryote mit einer multifunktionalen RNA-Polymerase I, die neben ribosomal Genen Gene Codieren der Parasit gr&ouml;&szlig;eren Zelloberfl&auml;che Proteine-die Variante Oberfl&auml;che Glykoprotein (VSG) und Procyclin &uuml;bertr&auml;gt. In den S&auml;ugetier-Blutkreislauf ist Antigene Variation der VSG-Mantel der Parasit Mittel, um die Immunantwort zu entgehen, w&auml;hrend Procyclin f&uuml;r effektive Einrichtung der Trypanosomatida Infektion im Flugteil notwendig ist. Au&szlig;erdem ist die au&szlig;ergew&ouml;hnlich hohe Effizienz der Mono-Allele VSG-Ausdruck wesentlich Trypanosomen Blutbahn, da seine Unterdr&uuml;ckender rapid Zellzyklus Verhaftung in-vitro verursacht und Abfertigung der Parasiten von infizierten M&auml;usen. Hier beschreiben wir ein neues Protein-komplexen, die Klasse erkennt ich Promotoren und ist unverzichtbar f&uuml;r Klasse I Transkription; Es besteht aus einer leichten Kette von Dynein und sechs Polypeptiden, die nur unter Trypanosomatid Parasiten konserviert werden. Entsprechend einer transkriptionelle Hauptfunktion des Komplexes Unterdr&uuml;ckender Ausdruck eine wichtige Untereinheit war t&ouml;dlich, Trypanosomen Blutbahn und speziell betroffen die F&uuml;lle der rRNA und VSG-mRNA. Der Komplex wurde genannt Klasse I &Uuml;bertragungfaktor A.

Multifunktional Klasse I Transkription in Trypanosoma Brucei ein neues Protein komplexe abh&auml;ngt.

A novel bacteriophage infecting Escherichia coli was isolated during a large-scale screen for bacteriophages that may be used for therapy of mastitis in cattle. The 77,554-bp genome of the bacteriophage, named phiEco32, was sequenced and annotated, and its virions were characterized by electron microscopy and proteomics. Two phiEco32-encoded proteins that interact with host RNA polymerase were identified. One of them is an ECF family sigma factor that may be responsible for transcription of some viral genes. Another RNA polymerase-binding protein is a novel transcription inhibitor whose mechanism of action remains to be defined.

Genomic and proteomic analysis of phiEco32, a novel Escherichia coli bacteriophage.

Eine neuartige Bakteriophage infizieren Escherichia coli wurde w&auml;hrend der gro&szlig;en Leinwand f&uuml;r Bakteriophagen, die f&uuml;r die Therapie der Mastitis bei Rindern kann isoliert. Der Bakteriophage, benannt phiEco32, 77.554-bp Genom sequenziert und kommentierte war und seine Virionen zeichneten sich durch Elektronenmikroskopie und Proteomik. Zwei phiEco32-kodierten Proteine, die mit Host der RNS-Polymerase interagieren wurden identifiziert. Einer von ihnen ist ein ECF Familie Sigma-Faktor, der f&uuml;r die Transkription von einigen viralen Genen verantwortlich sein k&ouml;nnen. Ein weiterer RNA-Polymerase-verbindliches Protein ist ein neuartiger Transkription-Hemmer, dessen Wirkmechanismus bleibt definiert werden.

Genomic und Proteomic Analyse der phiEco32, eine neuartige Escherichia-coli-Bakteriophage.

A previously unrecognized function of normal human hemoglobins occurring during protein assembly is described, i.e. self-regulation of subunit pairings and their durations arising from the variable strengths of their subunit interactions. Although many mutant human hemoglobins are known to have altered subunit interface strengths, those of the normal embryonic, fetal, and adult human hemoglobins have not been considered to differ significantly. However, in a comprehensive study of both types of subunit interfaces of seven of the eight normal oxy human hemoglobins, we found that the strengths, i.e., the free energies of the tetramer-dimer interfaces, contrary to previous reports, differ by 3 orders of magnitude and display an undulating profile similar to the transitions ("switches") of various globin subunit types over time. The dimer interface strengths are also variable and correlate linearly with their developmental profile. Embryonic hemoglobins are the weakest; fetal hemoglobin is of intermediate strength, and adult hemoglobins are the strongest. The pattern also correlates generally with their different O(2) affinities and responses to allosteric regulatory molecules. Acetylation of fetal hemoglobin weakens its unusually strong subunit interactions and occurs progressively as its level of expression diminishes and adult hemoglobin A formation begins; a causal relationship is suggested. The relative contributions of globin gene order and competition among subunits due to differences in their interface strengths were found to be complementary and establish a connection among genetics, thermodynamics, and development.

Energetic differences at the subunit interfaces of normal human hemoglobins correlate with their developmental profile.

Eine zuvor unbekannte Funktion des normalen menschlichen H&auml;moglobin vorkommende Protein Montage wird beschrieben, d.h. die Selbstregulierung der Untereinheit Paarungen und deren Dauer, die durch die Variablen st&auml;rken ihre Untereinheit Interaktionen. Obwohl viele Mutante menschliche H&auml;moglobin bekannt ist, dass die Untereinheit Schnittstelle st&auml;rken ver&auml;ndert haben, sind die von der normalen embryonalen und fetalen Erwachsenen menschlichen H&auml;moglobin nicht betrachtet worden, erheblich abweichen. Jedoch in einer umfassenden Studie der beiden Schnittstellentypen Untereinheit von sieben der acht normalen Autogen menschlichen H&auml;moglobin fanden wir, dass die st&auml;rken, d.h. die freie Energie der Tetramer-Dimer Schnittstellen, entgegen fr&uuml;herer Berichte durch 3 Gr&ouml;&szlig;enordnungen unterscheiden und einem welligen Profil &auml;hnlich wie die &Uuml;berg&auml;nge (&quot;Schalter&quot;) der verschiedenen Arten der Globin-Untereinheit im Laufe der Zeit zeigen. Die Dimer Schnittstelle st&auml;rken sind ebenfalls variabel und linear mit Entwicklungsst&ouml;rungen Profil korrelieren. Embryonale H&auml;moglobin sind die schw&auml;chsten; Fetales H&auml;moglobin ist der mittlere St&auml;rke und Erwachsene H&auml;moglobin sind die st&auml;rksten. Das Muster korreliert im Allgemeinen auch mit ihren verschiedenen O(2) Affinit&auml;ten und Antworten zu allosterischer regulatorische Molek&uuml;le. Acetylierung des fetalen H&auml;moglobins schw&auml;cht seine ungew&ouml;hnlich starke Untereinheit Interaktionen und tritt nach und nach verringert das Niveau des Ausdrucks und Erwachsene H&auml;moglobin A Bildung beginnt; eine kausale Beziehung wird vorgeschlagen. Die relative Beitr&auml;ge von Globin gen Reihenfolge und Wettbewerb zwischen den Untereinheiten aufgrund von Unterschieden in ihrer Schnittstelle st&auml;rken fanden sich zu erg&auml;nzen und eine Verbindung zwischen Genetik, Thermodynamik und Entwicklung herzustellen.

Energetische Unterschiede an den Schnittstellen der Untereinheit des normalen menschlichen H&auml;moglobin korrelieren mit ihrer Entwicklungs-Profil.

The transcription-repair coupling factor (TRCF, the product of the mfd gene) is a widely conserved bacterial protein that mediates transcription-coupled DNA repair. TRCF uses its ATP-dependent DNA translocase activity to remove transcription complexes stalled at sites of DNA damage, and stimulates repair by recruiting components of the nucleotide excision repair pathway to the site. A protein/protein interaction between TRCF and the Î²-subunit of RNA polymerase (RNAP) is essential for TRCF function. CarD (also called CdnL), an essential regulator of rRNA transcription in Mycobacterium tuberculosis, shares a homologous RNAP interacting domain with TRCF and also interacts with the RNAP Î²-subunit. We determined the 2.9-Ã… resolution X-ray crystal structure of the RNAP interacting domain of TRCF complexed with the RNAP-Î²1 domain, which harbors the TRCF interaction determinants. The structure reveals details of the TRCF/RNAP protein/protein interface, providing a basis for the design and interpretation of experiments probing TRCF, and by homology CarD, function and interactions with the RNAP.

Structural basis for the bacterial transcription-repair coupling factor/RNA polymerase interaction.

Die Transkription-Reparatur-Kopplungsfaktor (TRCF, das Produkt des Gens Mfd) ist ein weithin konservierten bakterielle Protein, die Transkription-gekoppelter DNA-Reparatur vermittelt. TRCF verwendet seine ATP-abh&auml;ngige DNA-Translokase-Aktivit&auml;t, um Transkription-komplexe, die ins Stocken geraten an Standorten von DNA-Sch&auml;den zu entfernen und stimuliert die Reparatur durch Anwerben von Komponenten der Nukleotid Exzision Reparatur Pfad zum Ortsbild. Eine Protein/Protein-Interaktion zwischen TRCF und der &beta;-Untereinheit der RNA-Polymerase (Name) unbedingt TRCF Funktion. Karte (auch genannt CdnL), eine wesentliche Regulator der rRNA-Transkription in Mycobacterium Tuberculosis, teilt eine homologe interagierende Name-Domain mit TRCF und interagiert auch mit der Name &beta;-Untereinheit. Wir entschlossen die 2.9-&Aring; Aufl&ouml;sung R&ouml;ntgen Kristallstruktur der Name interagierenden Dom&auml;ne des TRCF komplexiert mit der Name-&beta;1 Dom&auml;ne, die die TRCF Interaktion Determinanten hegt. Die Struktur zeigt Details der TRCF/Name Eiwei&szlig;/Protein-Schnittstelle, die eine Grundlage f&uuml;r die Gestaltung und Auslegung von Experimenten, die Sondierung TRCF und Homologie CarD, Funktion und Interaktionen mit der Name.

Strukturelle Grundlage f&uuml;r die bakterielle Transkription-Reparatur Kupplung Faktor/RNA-Polymerase-Interaktion.

A high-capacity ion trap coupled to a time-of-flight (TOF) mass spectrometer has been developed to carry out comprehensive linked scan analysis of all stored ions in the ion trap. The approach involves a novel tapered geometry high-capacity ion trap that can store more than 10(6) ions (range 800-4000 m/z) without degrading its performance. Ions are stored and scanned out from the high-capacity ion trap as a function of m/z, collisionally fragmented and analyzed by TOF. Accurate mass analysis is achieved on both the precursor and fragment ions of all species ejected from the ion trap. We demonstrate the approach for comprehensive linked-scan identification of phosphopeptides in mixtures with their corresponding unphosphorylated peptides.

High-Capacity Ion Trap Coupled to a Time-of-Flight Mass Spectrometer for Comprehensive Linked Scans with no Scanning Losses.

Ein hoher Kapazit&auml;t Ionenfalle, gekoppelt mit einem Time-of-Flight (TOF)-Massenspektrometer wurde entwickelt, um die umfassenden verkn&uuml;pfte Scan Analyse aller gespeicherten Ionen in die Ionenfalle durchf&uuml;hren. Der Ansatz beinhaltet eine neuartige konische Geometrie Hochleistungs-Ionenfalle, die gespeichert werden k&ouml;nnen, die mehr als 10 6 Ionen (Reichweite 800-4000 m/Z) ohne seine Performance-Einbu&szlig;en. Ionen sind gespeichert und gescannt raus aus der Ionenfalle hoher Kapazit&auml;t als Funktion der m/Z, collisionally fragmentiert und von TOF analysiert. Genaue Masse Analyse erfolgt auf Vorl&auml;ufer sowohl der Fragment-Ionen aller Arten von der Ionenfalle ausgeworfen. Wir zeigen den Ansatz f&uuml;r die umfassende verkn&uuml;pft-Scan-Identifizierung des Phosphopeptides in Mischungen mit ihren entsprechenden unphosphorylated Peptiden.

Hoher Kapazit&auml;t Ionenfalle Kopplung mit einer Time-of-Flight-Massenspektrometer f&uuml;r umfassende verkn&uuml;pfte scannt mit keine Scan-Verluste.

The expression of the six types of human Hb subunits over time is currently considered to be regulated mainly by transcription factors that bind to upstream control regions of the gene (the 'extrinsic' component of regulation). Here, we describe how subunit pairing and further assembly to tetramers in the liganded state is influenced by the affinity of subunits for one another (the 'intrinsic' component of regulation). The adult Hb dimers have the strongest subunit interfaces and the embryonic Hbs the weakest, with fetal Hbs being of intermediate strength, corresponding to the temporal order of their expression. These variable subunit binding strengths and the attenuating effects of acetylation contribute to the differences with which these Hb types form functional O(2) -binding tetramers consistent with gene switching.

Intrinsic regulation of hemoglobin expression by variable subunit interface strengths.

Der Ausdruck der sechs Arten von menschlichen Hb Untereinheiten im Laufe der Zeit gilt derzeit vor allem von Transkriptionsfaktoren reguliert werden, die vorgeschaltete Kontrolle Regionen des Gens (die &quot;extrinsische&quot; Komponente der Verordnung) binden. Hier beschreiben wir, wie Untereinheit Paarung und weitere Assembly in tetrameren im liganded Zustand ist beeinflusst durch die Affinit&auml;t der Untereinheiten f&uuml;reinander (die &#39;inneren&#39; Komponente der Verordnung). Die Erwachsenen Hb-Dimer haben die st&auml;rksten Untereinheit-Schnittstellen und embryonalen HB die schw&auml;chsten mit fetalen Hbs wird der mittlere St&auml;rke, entsprechend der zeitlichen Reihenfolge ihres Ausdrucks. Diese Variable Untereinheit Bindung st&auml;rken und die d&auml;mpfenden Effekte der Acetylierung dazu beitragen, die Unterschiede, mit denen diese Hb-Arten funktionelle O(2) bilden-Bindung tetrameren mit Gen wechseln.

Systeminterne Verordnung H&auml;moglobin Ausdrucks durch Variable Untereinheit Schnittstelle st&auml;rken.

We have discovered that an electrode containing a conical channel with a small angular divergence can transmit into the vacuum almost 100% of an electrospray ion current produced at atmospheric pressure. Our first implementation of such a conical duct, which we term "ConDuct," uses a conductive plastic pipette tip containing an approximately 1.6° divergent channel at its entrance. We observed that the beam formed by the ConDuct electrode has a very low divergence (less than 1°) and persists for long distances in vacuum. Intrigued by these properties, we incorporated this electrode into a novel atmosphere-to-vacuum ion transmission interface, and devised a technique for evaluating its performance relative to the commercial reference interfaces that contain heated metal capillaries. We determined that our new interface transmits at least 400 times more ions than the commercial Thermo LCQ DECA XP atmosphere-to-vacuum interface and 2 to 3 times more than the commercial interface in the Thermo Velos Orbitrap and the Q Exactive mass spectrometers. We conclude that it might be possible to optimize the properties of the transmitted ions further by manufacturing ConDuct inlet electrodes from metal rather than conductive plastic and by determining the optimum angle of channel divergence and channel length.

Maximizing ion transmission from atmospheric pressure into the vacuum of mass spectrometers with a novel electrospray interface.

We demonstrate that the efficiency of ion transmission from atmosphere to vacuum through stainless steel electrodes that contain slowly divergent conical duct (ConDuct) channels can be close to 100%. Here, we explore the properties of 2.5-cm-long electrodes with angles of divergence of 0°, 1°, 2°, 3°, 5°, 8°, 13°, and 21°, respectively. The ion transmission efficiency was observed to jump from 10-20% for the 0° (straight) channels to 90-95% for channels with an angle of divergence as small as 1°. Furthermore, the 2-3° ConDuct electrodes produced extraordinarily low divergence ion beams that propagated in a laser-like fashion over long distances in vacuum. To take advantage of these newly discovered properties, we constructed a novel atmosphere-to-vacuum ion interface utilizing a 2° ConDuct as an inlet electrode and compared its ion transmission efficiency with that of the interface used in the commercial (Thermo Fisher Scientific, San Jose, CA, USA) Velos Orbitrap and Q Exactive mass spectrometers. We observed that the ConDuct interface transmitted up to 17 times more ions than the commercial reference interface and also yielded improved signal-to-noise mass spectra of peptides. We infer from these results that the performance of many current atmosphere-to-vacuum interfaces utilizing metal capillaries can be substantially improved by replacing them with 1° or 2° metal ConDuct electrodes, which should preserve the convenience of supplying ion desolvation energy by heating the electrode while greatly increasing the efficiency of ion transmission into the mass spectrometer.

Article	Year
Mnb/Dyrk1A phosphorylation regulates the interaction of dynamin 1 with SH3 domain-containing proteins. Biochemistry\| PubMed ID: 15287745	2004
N-terminal acetylation and protonation of individual hemoglobin subunits: position-dependent effects on tetramer strength and cooperativity. Protein science : a publication of the Protein Society\| PubMed ID: 15929996	2005
Quantitative analysis of protein phosphorylation in mouse brain by hypothesis-driven multistage mass spectrometry. Analytical chemistry\| PubMed ID: 16351129	2005
Low molecular weight squash trypsin inhibitors from Sechium edule seeds. Phytochemistry\| PubMed ID: 16406091	2006
Human embryonic, fetal, and adult hemoglobins have different subunit interface strengths. Correlation with lifespan in the red cell. Protein science : a publication of the Protein Society\| PubMed ID: 17656582	2007
Multifunctional class I transcription in Trypanosoma brucei depends on a novel protein complex. The EMBO journal\| PubMed ID: 17972917	2007
Genomic and proteomic analysis of phiEco32, a novel Escherichia coli bacteriophage. Journal of molecular biology\| PubMed ID: 18294652	2008
Energetic differences at the subunit interfaces of normal human hemoglobins correlate with their developmental profile. Biochemistry\| PubMed ID: 19583196	2009
Structural basis for the bacterial transcription-repair coupling factor/RNA polymerase interaction. Nucleic acids research\| PubMed ID: 20702425	2010
High-Capacity Ion Trap Coupled to a Time-of-Flight Mass Spectrometer for Comprehensive Linked Scans with no Scanning Losses. International journal of mass spectrometry\| PubMed ID: 21516228	2011
Intrinsic regulation of hemoglobin expression by variable subunit interface strengths. The FEBS journal\| PubMed ID: 22129306	2012
Maximizing ion transmission from atmospheric pressure into the vacuum of mass spectrometers with a novel electrospray interface. Journal of the American Society for Mass Spectrometry\| PubMed ID: 25588722	2015
Optimizing Electrospray Interfaces Using Slowly Diverging Conical Duct (ConDuct) Electrodes. Journal of the American Society for Mass Spectrometry\| PubMed ID: 25667060	2015

Julio C. Padovan

Biography

JoVE Journal Publications

Other Publications